Scaffold Ga0074213_130052

Overview

Basic Information

• Taxon OID: 3300005488
• Scaffold ID: Ga0074213_130052
• Source Dataset Name: Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Methane enrichment
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 654
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa

Source Dataset Sampling Location

• Location Name: Lake Washington, Seattle, USA
• Coordinates
  • Lat. (^o): 47.63458
  • Long. (^o): -122.26655
  • Depth (m): 63

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090578	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074213_1300522	F090578	N/A	MWDTNLWAPWGLIHAVRDGSPVISETGLWFLFQRHPEAVETDGEAYWLYLDQPYRAERVPGRAFYQLASAPSRQRGG*