NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068474_115297

Scaffold Ga0068474_115297


Overview

Basic Information
Taxon OID3300005465 Open in IMG/M
Scaffold IDGa0068474_115297 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0025m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2292
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001479Metagenome / Metatranscriptome687Y
F007173Metagenome / Metatranscriptome356Y
F020546Metagenome / Metatranscriptome223Y

Sequences

Protein IDFamilyRBSSequence
Ga0068474_1152971F007173AGGAGMQTITKAKISRNNLMEYIHEDRDLLMGLQDDLSDMLYATGKFSIDLNEIVNEYMPYIPLYLIENEDEIKEVYSDRIDDDDNLFIFDRDKTPTSINLYVEWID*
Ga0068474_1152972F001479AGGAGMSKEMLFLCDVYDAWLIKNKLPHRCASEILYGADTMNKLTVNQSYWLESFISTWDVIADNT*
Ga0068474_1152974F020546GGAGGMTTKTDPNKDFTIKEFYIKVKGDYGKEKTVRVNDMGDKLLTLITDLGWEYQRMSRSGQEVFDEIHQLLGTIKEDEVYMEI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.