| Basic Information | |
|---|---|
| Taxon OID | 3300005434 Open in IMG/M |
| Scaffold ID | Ga0070709_10084798 Open in IMG/M |
| Source Dataset Name | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2076 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan: Kellogg Biological Station | |||||||
| Coordinates | Lat. (o) | 42.4774 | Long. (o) | -85.451 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019240 | Metagenome / Metatranscriptome | 231 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0070709_100847981 | F019240 | AGGA | MERPEIVELLFSTLFAPNDIEPLSPFLSQRVEWILSAADRKTLGEEFPPNAIKFSGKQGFQELGLYFRDSLKVVSGDLTGCIPHHQLVFAFGRMRLQSPGASQPVETNIAASITFLRSKIIKFQIRVSWPLVF* |
| ⦗Top⦘ |