Scaffold Ga0066826_10207325

Overview

Basic Information

• Taxon OID: 3300005424
• Scaffold ID: Ga0066826_10207325
• Source Dataset Name: Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 676
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Eastern Tropical North Pacific
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019330	Metagenome	230	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066826_102073251	F019330	N/A	HPIQEERYLSTYDDGVETIGPETETYDRTVDKTNWGWPTAPDAEVDKYHVRYI*