NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0008090_15863282

Scaffold Ga0008090_15863282


Overview

Basic Information
Taxon OID3300005363 Open in IMG/M
Scaffold IDGa0008090_15863282 Open in IMG/M
Source Dataset NameTropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1103
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil → Tropical Rainforest Soil Microbial Communities From The Amazon Forest, Brazil, For Analyzing Deforestation At Different Spatial Scales

Source Dataset Sampling Location
Location NameAmazon Forest, Brazil
CoordinatesLat. (o)-10.0Long. (o)-62.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103960Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0008090_158632823F103960AGGAGMKLRAKIFVTVVGFFAQLFFVTPIHSDIIQTNDRTAQEIFGALATGQHSRTLVSLSPLVVEGRTLGQVLVYDDPATKRPVDYFELYDSTGDLVAVGWFDQFGIQRVAVDRGLLEKGDKVEGIYVFFLEGDSI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.