NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070671_100024323

Scaffold Ga0070671_100024323


Overview

Basic Information
Taxon OID3300005355 Open in IMG/M
Scaffold IDGa0070671_100024323 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4957
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017350Metagenome / Metatranscriptome241Y
F020724Metagenome / Metatranscriptome222Y
F061005Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0070671_1000243231F061005GGAGGVNRVFFGDLPTDAQAMLTRHLRVDFSHCIMKAPQWFSAWACNDRGHIIGIFTVEFPVWFEGKVTALVLDPRCLSRRTLRAIFTALFSKVKRLTAEVEPDNRRALKQVQRLGFIYEGYRPLGLEGTRDTIVYGMLKEDCRYLPGFEDDRPARTVPVFPGYVYE
Ga0070671_1000243233F020724N/AMARLATILQIVSDVSLELGTTQIPVLQALGSSDQDIAQITALMGNVADELLLDPPYRDALGDGNWIYDPGLLVRKDRPTQDTDIVLFDPRLAIDGLKYRFLKAKGLEYGEEQRDFIARLNKLAGRNAPVIDLNIDDGRVQ*
Ga0070671_1000243234F017350GGAGMSETPTLVRFYSGWERDGNGPDGLPAYRQTVRVRLDRPPLLSVEREAEEADILNHPEPYALYQRTEAVRIEVHGYPLALWPACLPHLFQMCAARDIHTVEQLAQLVTKTRRSEAAKTMPPDVLELADRARKMIELQSKAGQYEELITDLQSQVEVLKEQITEAAQTIASQKTMIDTLKLKAAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.