Scaffold Ga0070669_100445737

Overview

Basic Information

• Taxon OID: 3300005353
• Scaffold ID: Ga0070669_100445737
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1066
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan, Kellogg Biological Station
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044382	Metagenome	154	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070669_1004457372	F044382	N/A	AQEALKFAKRVGQPDAQVRLLVLIGELRMNANAAAARKSFQDARLLAEERAPHLLRVIFDRWSHAAESTGDSEEALRLARRALETART*