Scaffold Ga0074242_11847062

Overview

Basic Information

• Taxon OID: 3300005346
• Scaffold ID: Ga0074242_11847062
• Source Dataset Name: Saline sediment microbial community from Etoliko Lagoon, Greece
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 984
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Etoliko Lagoon, Greece
• Coordinates
  • Lat. (^o): 38.482158
  • Long. (^o): 21.313175

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033024	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074242_118470622	F033024	N/A	ADPRQAAPQQYVRPQMPVPPQPQSQGNPADFWNSFGGLAERDPANAWRYLNAAQQNPEVFRSKMLVME*