NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074242_10437981

Scaffold Ga0074242_10437981


Overview

Basic Information
Taxon OID3300005346 Open in IMG/M
Scaffold IDGa0074242_10437981 Open in IMG/M
Source Dataset NameSaline sediment microbial community from Etoliko Lagoon, Greece
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3229
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location NameEtoliko Lagoon, Greece
CoordinatesLat. (o)38.482158Long. (o)21.313175Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022176Metagenome215Y
F025263Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0074242_104379812F025263GAGGMAINPNQLHVAKIYPGNYTNVLRYWHEEKTVQYDNANGVSQNLANQPIGGPVGVVFRPGWIAQQAVGYVDLSYQALGTVNQLSYYTQPYGSGQPFSSASIIIPSPDFHKDVRADISNGIGAPAGAFVYRASLRVDGGDVVSSGIAGGSTTPKISLVPAVGEGLLDDGTVVSGQFGVSVTGSDSRIANGSTASVNIIDSSSLAALSTETQWQLFATTDLGGASGLAPGSGVYDPRASANKLAGDDKALAICEVCWIIPDEPPERQDVALQPDGLVESSVYTSTSPS*
Ga0074242_104379815F022176N/AVAQLSQNELEQIQSYLAQQGVTFDATSTDASKRETIYAAVNQLTRNPAQVFGYRLDDFNFSRVAYHLGYNIATVPAGDYARLLEASNSIP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.