NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070687_100287915

Scaffold Ga0070687_100287915


Overview

Basic Information
Taxon OID3300005343 Open in IMG/M
Scaffold IDGa0070687_100287915 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1037
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033479Metagenome / Metatranscriptome177Y
F054961Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0070687_1002879151F054961N/ASSFTSDVDMRRYLHAFIAALTMCLLTVVDGARAQTPEHRFAPGTPPIAVRPSALAQIVSELAGSPVNVQRARILWVIDSHAVVIESDSAFDPTWRDRGRVLVMLERSRSLSIPRPPVSIAPVNVLGIARTLLGIQAAQDVPWPQALTRREIERLGIRAAILATSVRTSDGVELTSSTAAP
Ga0070687_1002879152F033479AGGMTRWMAMLPAIALAGCATTSSSLVRGMTAPNPSGCYIQVFDGERLRGVADFINGPMRYSSLSRLPNGTDWTGRIRSIEVGPAATATIWTEVNQSGQSMNLLLDRRYPALPE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.