NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066388_100000359

Scaffold Ga0066388_100000359


Overview

Basic Information
Taxon OID3300005332 Open in IMG/M
Scaffold IDGa0066388_100000359 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20849
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (80.95%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F002850Metagenome / Metatranscriptome526Y
F004352Metagenome / Metatranscriptome442Y
F006575Metagenome / Metatranscriptome370Y

Sequences

Protein IDFamilyRBSSequence
Ga0066388_10000035911F006575GGAGMTEQERAVEPAAAASPYLSLRQAVRPAILAHGLLAGDRERAGKLAAECEDLLYLTRELLRAAGRARILTAGPVPETPDQSGGDRQAQLLDAYADAGLLWAKVVGSALALAGVLIERGDWDDVRRLAGCLAGAGEDDAALELRIELGKAMWARHDQALRAIGNRMPPTAIGAAIDALRAVLRDVPEAFPDRNRQVNRFLPPLAASILAVMKDQRADIPYHSRVEHIATGGVAKYPDIVTTSLDELAAEFEGVCRRPGRETE*
Ga0066388_10000035912F001698AGGAGMAGVINDVEALAEFRANLMQFNRDLAEHFATIQRHWRELGEVWRDDMYRLFGEALEEVTPGIKAYLAATEGHEAHLAALIERLSGYLETGAGAGLGVGRPDSGRGRGQRDGAA*
Ga0066388_10000035913F002850N/AVTAVHADIDALKGLHAALVRYRHGQRDVAARGEDQIRLTRAALETRASQWRSRLELGQAEFAGCQDRAAQAPPDSPVDCSGYARAVEQSRERLEQIQRWQQRIDAEASEFGGTAGRFLDLLENELPGIERQLLAIIGSLEAARRVRAPGA*
Ga0066388_10000035914F004352GGCGGVPTRPDQDGDQQLRLLEDAWDMAAEHWRDGQARQFGDGRLAPLLQESRGYLEALRRLMDTLEAAERDTEG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.