Scaffold Ga0074195_1128525

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074195_1128525

Scaffold Ga0074195_1128525

Overview

Basic Information
Taxon OID	3300005326 Open in IMG/M
Scaffold ID	Ga0074195_1128525 Open in IMG/M
Source Dataset Name	Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	647
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Source Dataset Sampling Location
Location Name	Espanola, New Mexico, United States
Coordinates	Lat. (^o)	35.9918	Long. (^o)	-106.0796	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071903	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074195_11285252	F071903	AGGAGG	MNRTEQAAARHEAELQEALGHLEYFKRTALALDQAMKVMAKDLQVCKKNEQIWEKRIAKMQEKA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.