| Basic Information | |
|---|---|
| Taxon OID | 3300005326 Open in IMG/M |
| Scaffold ID | Ga0074195_1065327 Open in IMG/M |
| Source Dataset Name | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1116 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Espanola, New Mexico, United States | |||||||
| Coordinates | Lat. (o) | 35.9918 | Long. (o) | -106.0796 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038519 | Metagenome | 165 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074195_10653272 | F038519 | AGGAGG | MKMFAVDYAVGEDAAGPYTDEDLLQKTLAIIRQIDPDADIISRECNPFSDQILAGLLPFKIHVDLLDGIPQLPADVQITWPPGEMEGIQFGNLECREYFVWAESEKAALRKLATLNKAAPNYNPKAAAM* |
| ⦗Top⦘ |