Scaffold Ga0065707_10622868

Overview

Basic Information

• Taxon OID: 3300005295
• Scaffold ID: Ga0065707_10622868
• Source Dataset Name: Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 662
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location

• Location Name: East Lansing, MI
• Coordinates
  • Lat. (^o): 42.794771
  • Long. (^o): -84.393804

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105992	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0065707_106228681	F105992	GGAGG	MTAIPVQFPDESVKLDDVEEGRVLTALEVMYEGGSLHGKTADFPSRDLERVVLHVHGRNRHFFQTYERTICVDIRSRRTIFRYAGLSSKSNNSSWWKRLLCHDCPAKRKSENANEYRVQFAALRLRKVKPIVI*