| Basic Information | |
|---|---|
| Taxon OID | 3300005295 Open in IMG/M |
| Scaffold ID | Ga0065707_10017432 Open in IMG/M |
| Source Dataset Name | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2761 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | East Lansing, MI | |||||||
| Coordinates | Lat. (o) | 42.794771 | Long. (o) | -84.393804 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053202 | Metagenome / Metatranscriptome | 141 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065707_100174323 | F053202 | GGAG | MYRAASLRLVLSVACMTASSAPAFAQVVPTGKVATFDGQGANAWSGNIRASDDELVGLLEEGIKRSPTFKGLVDRLAKSDVILYVRPDVTAKNNVMKMTFLAAKGGYRYLVIRVAAGRSKDQQLATLGHEMQHAVTIADASSVVDSASLRREFERVGKLTQPSVGDDFFFDSPAAEEVRRRILAEISQK* |
| ⦗Top⦘ |