NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065705_10017131

Scaffold Ga0065705_10017131


Overview

Basic Information
Taxon OID3300005294 Open in IMG/M
Scaffold IDGa0065705_10017131 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2685
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameEast Lansing, MI
CoordinatesLat. (o)42.794771Long. (o)-84.393804Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069375Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0065705_100171312F069375AGAAGGMRRLSVLGALFAVVSLAVMASSASSAPIVEQFHGTFSDTFQDNVCGIDGTTVVSGMDNIQVFADGTFKDEFRQNYVFTSAATGKSVLLFVAQQFIGTGPIDNGDGTVTFTSTFKGLPEKVKLPNGRVLLRDAGFVTFNDTFDATTGDFLGTTISPENGPHPDLDSGFTLFCDVIVPALS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.