Basic Information | |
---|---|
Taxon OID | 3300005293 Open in IMG/M |
Scaffold ID | Ga0065715_11135074 Open in IMG/M |
Source Dataset Name | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 512 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kellogg Biological Station, Michigan State University | |||||||
Coordinates | Lat. (o) | 42.406189 | Long. (o) | -85.40016 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023968 | Metagenome / Metatranscriptome | 208 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0065715_111350741 | F023968 | N/A | AAKNFVDTWLIRKDYDAAFRYLSTRSYACYDILRGPDAPASTSLDDAGLKVRASLQRIGQWVGTERNLETIIEAAEPLHPSIRLMDHAYSQMFSLTSFPTALGDAVACDARARGAIPPDPLPLTYDDAFGMTFRFRTQSGDTPVLRLLWRKEDGVWRVTSYDVDVP* |
⦗Top⦘ |