Scaffold Ga0065704_10803969

Overview

Basic Information

• Taxon OID: 3300005289
• Scaffold ID: Ga0065704_10803969
• Source Dataset Name: Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 524
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location

• Location Name: East Lansing, MI
• Coordinates
  • Lat. (^o): 42.794771
  • Long. (^o): -84.393804

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085425	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065704_108039691	F085425	AGG	MLEGVLIDQAIEVLFQRARDFGRSTGARAIQQPLEPLLGKTLYPFAQGRIRHMEGGGDGGDVLTCDHRMDSLGTAQDTRLLGL