Basic Information | |
---|---|
Taxon OID | 3300005283 Open in IMG/M |
Scaffold ID | Ga0065725_11032135 Open in IMG/M |
Source Dataset Name | Nasutitermes corniger P1 gut segment microbial communitites from University of Florida, USA - Alkaline Insect Gut Metagenome: eDNA_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 502 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Hindgut → P1 Segment → Nasutitermes Corniger Hindgut → Nasutitermes Corniger Hindgut Microbial Communities From The University Of Florida, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Florida, USA | |||||||
Coordinates | Lat. (o) | 26.135833 | Long. (o) | -80.129444 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030925 | Metagenome | 184 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0065725_110321351 | F030925 | AGAAG | MTNKMQLCGINLFFPCSLAALHVSSDIIAHHQEHQTVVTASGFIPRVVVGC |
⦗Top⦘ |