Scaffold Ga0065725_10011617

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065725_10011617

Scaffold Ga0065725_10011617

Overview

Basic Information
Taxon OID	3300005283 Open in IMG/M
Scaffold ID	Ga0065725_10011617 Open in IMG/M
Source Dataset Name	Nasutitermes corniger P1 gut segment microbial communitites from University of Florida, USA - Alkaline Insect Gut Metagenome: eDNA_1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	592
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Hindgut → P1 Segment → Nasutitermes Corniger Hindgut → Nasutitermes Corniger Hindgut Microbial Communities From The University Of Florida, Usa

Source Dataset Sampling Location
Location Name	Florida, USA
Coordinates	Lat. (^o)	26.135833	Long. (^o)	-80.129444	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068987	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065725_100116171	F068987	N/A	ATCYFRQPSMNLTRYQKGVYYLGVKVFNMLTSYIKIESDNPKKFKLIVQKLFCENSFYFWDEHFELQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.