Scaffold Ga0065725_10000132

Overview

Basic Information

• Taxon OID: 3300005283
• Scaffold ID: Ga0065725_10000132
• Source Dataset Name: Nasutitermes corniger P1 gut segment microbial communitites from University of Florida, USA - Alkaline Insect Gut Metagenome: eDNA_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 6343
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Hindgut → P1 Segment → Nasutitermes Corniger Hindgut → Nasutitermes Corniger Hindgut Microbial Communities From The University Of Florida, Usa

Source Dataset Sampling Location

• Location Name: Florida, USA
• Coordinates
  • Lat. (^o): 26.135833
  • Long. (^o): -80.129444

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037468	Metagenome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065725_100001321	F037468	GAG	MVVLLQNCFDLRSGELGLRATSSEVGNEVIHVQVEGVGEVTGGEDCEPMTSPLTDAEVGFMSPDCVACFIGIQNCLSVSI*