| Basic Information | |
|---|---|
| Taxon OID | 3300005283 Open in IMG/M |
| Scaffold ID | Ga0065725_10000007 Open in IMG/M |
| Source Dataset Name | Nasutitermes corniger P1 gut segment microbial communitites from University of Florida, USA - Alkaline Insect Gut Metagenome: eDNA_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4918 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Auchenorrhyncha → Fulgoromorpha → Fulgoroidea → Delphacidae → Delphacinae → Nilaparvata → Nilaparvata lugens | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Hindgut → P1 Segment → Nasutitermes Corniger Hindgut → Nasutitermes Corniger Hindgut Microbial Communities From The University Of Florida, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Florida, USA | |||||||
| Coordinates | Lat. (o) | 26.135833 | Long. (o) | -80.129444 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021794 | Metagenome | 217 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065725_100000072 | F021794 | N/A | MASCCLGRQATVSNFTILLIHVLHVLHPAALEGSTHYARQIVVNFFSKHTQTDVSYIEPHNHKFRNLTAESRLEIAFAGKLKGLKIPNHKLYKYELSEGLAVVFEVETRLIKWYLPPHCDFDVLEAERTDYVPLSGYTQRQVADMRVSYMNA* |
| ⦗Top⦘ |