Scaffold Ga0065725_10000006

Overview

Basic Information

• Taxon OID: 3300005283
• Scaffold ID: Ga0065725_10000006
• Source Dataset Name: Nasutitermes corniger P1 gut segment microbial communitites from University of Florida, USA - Alkaline Insect Gut Metagenome: eDNA_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 5030
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (11.11%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Kinetoplastea → Metakinetoplastina → Trypanosomatida → Trypanosomatidae → Leishmaniinae → Leishmania → Leishmania → Leishmania donovani species complex → Leishmania infantum (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Hindgut → P1 Segment → Nasutitermes Corniger Hindgut → Nasutitermes Corniger Hindgut Microbial Communities From The University Of Florida, Usa

Source Dataset Sampling Location

• Location Name: Florida, USA
• Coordinates
  • Lat. (^o): 26.135833
  • Long. (^o): -80.129444

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004932	Metagenome	418	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065725_100000064	F004932	N/A	MSTVLVNVKEMFSFQQGLSRTTVHLIVESCQHLKKLSLPYVQQFFDDDVIHVINKLGKQLTTLVLGEYQLTDVANLYLSNCTR*