| Basic Information | |
|---|---|
| Taxon OID | 3300005280 Open in IMG/M |
| Scaffold ID | Ga0065696_1078585 Open in IMG/M |
| Source Dataset Name | Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 532 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil → Switchgrass Rhizosphere Bulk Soil Microbial Community From Michigan, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | East Lansing, MI | |||||||
| Coordinates | Lat. (o) | 42.704677 | Long. (o) | -84.468818 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002570 | Metagenome / Metatranscriptome | 547 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065696_10785851 | F002570 | N/A | KTKLTLTLITLAGLIVCASFIAGGTSAAPMVDDKVNPHYKGGSSFNLAGAGPNVARCGAFPENIELSFTGAGIDTEGGYNTAVFSACTNTTTNLVFDLKATDTYAGSGDSVNIEGDPFVLVPNPAICAAANAHGVPFRVAGAQEPTPARPALAVSTITSNLTPCNGLTPPSQVWFE |
| ⦗Top⦘ |