| Basic Information | |
|---|---|
| Taxon OID | 3300005278 Open in IMG/M |
| Scaffold ID | Ga0065718_1056678 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial communities from Great Boiling Spring, Nevada - cellulolytic enrichment CS 77C |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 642 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Great Boiling Spring, Nevada | |||||||
| Coordinates | Lat. (o) | 40.71458 | Long. (o) | -119.369659 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027047 | Metagenome | 196 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065718_10566782 | F027047 | GGGGG | MDLSSLGIAVLSAVVYSLSMYVKKHLNTDNPQSFDTTKFLTTLIWGIIVGAILQFSGVPITEQSVEEQFIAYAGLIAITENIIKAIIRAVDR* |
| ⦗Top⦘ |