| Basic Information | |
|---|---|
| Taxon OID | 3300005276 Open in IMG/M |
| Scaffold ID | Ga0065717_1002390 Open in IMG/M |
| Source Dataset Name | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2057 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of North Carolina | |||||||
| Coordinates | Lat. (o) | 35.9 | Long. (o) | -79.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029741 | Metagenome / Metatranscriptome | 187 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065717_10023902 | F029741 | GGAG | MPVLAYFEVVGFVLAALLFVADATLERNSPAIVTSDRVGLPERWHSDTIRTLTTAPAPAPDMTSPAVLAAQPRSEPDILDKIGPAARAARAEAPSKNNRVTQSTGHRQNHDQTNQLADRFSIKGQ* |
| ⦗Top⦘ |