| Basic Information | |
|---|---|
| Taxon OID | 3300005275 Open in IMG/M |
| Scaffold ID | Ga0065719_109322 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial communities from Great Boiling Spring, Nevada - Cellulolytic enrichment CS 85C |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1041 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Great Boiling Spring, Nevada | |||||||
| Coordinates | Lat. (o) | 40.67 | Long. (o) | -119.37 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089858 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065719_1093221 | F089858 | N/A | FHVDGFYAEKLTREYVEREVRRKLSIPEFEESGLMEIIVSETGVDGLLNIPVKRGEXWIKELDDGRFAINLDDPDDPKITCAEVXXVREDLEEETIKAKDVKCVIIGDIPDMGRARFVRIREDVREVEEE* |
| ⦗Top⦘ |