Scaffold Ga0065719_100415

Overview

Basic Information

• Taxon OID: 3300005275
• Scaffold ID: Ga0065719_100415
• Source Dataset Name: Hot spring sediment microbial communities from Great Boiling Spring, Nevada - Cellulolytic enrichment CS 85C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 14300
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (77.78%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada

Source Dataset Sampling Location

• Location Name: Great Boiling Spring, Nevada
• Coordinates
  • Lat. (^o): 40.67
  • Long. (^o): -119.37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084856	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0065719_1004156	F084856	GAG	MSGTFNLTIVTHIYTSQHAEALKETLPEWVRLSPSQILVGYYQKXFQPSDFQCLETYDGVELVPVDSSSYGAAYDVLLERVVGKPILILAPYVIPKDWFVGSVSKWFESYAIIGHYKQPRILVADAILMPLIAPVVVELGRLQMDCIAVREDVPRSVGYHEWWFGSILVRARPGAFLLYNALAAGYPVLTLPYNCKPVRYVRNPERQSSKAHKK*