Scaffold Ga0065703_1025591

Overview

Basic Information

• Taxon OID: 3300005272
• Scaffold ID: Ga0065703_1025591
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 520
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location

• Location Name: Central Sands area of central Wisconsin
• Coordinates
  • Lat. (^o): 44.168815
  • Long. (^o): -89.633871

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005485	Metagenome	399	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065703_10255911	F005485	N/A	YRCKSCRRVTSYRRLFWRYRYVALIVAALIGVWTIPGLVNQRFTRGYDKLPPGALVSDETTMGWLGLTDKGWFCVEPHYKGNLLHLRHKVFQAKDVIVFVHGFIGDYVNTWGKPKVLLEDPRFNRNYDFVFYGFKTALFGDVPAFDEEAARLDRTLTHLEQDYSSITIVTHSK