Scaffold Ga0065702_100745

Overview

Basic Information

• Taxon OID: 3300005266
• Scaffold ID: Ga0065702_100745
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 603
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location

• Location Name: Central Sands area of central Wisconsin.
• Coordinates
  • Lat. (^o): 44.166906
  • Long. (^o): -89.649965

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069416	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065702_1007451	F069416	N/A	VQRITHVLREPLGPLLLGLEVLLREESLSPRGVEMIGVLQRGVKKEADAIEELLRSTELFEKDAAR*