Scaffold Ga0073580_116621

Overview

Basic Information

• Taxon OID: 3300005265
• Scaffold ID: Ga0073580_116621
• Source Dataset Name: Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4484. Combined assembly of Gp0115313 and Gp0146561
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Texas, Austin
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5701
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (92.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Hydrothermal Sediment Microbial Communities From Guaymas Basin, California, Usa

Source Dataset Sampling Location

• Location Name: Guaymus Basin
• Coordinates
  • Lat. (^o): 27.013056
  • Long. (^o): -111.519722
  • Depth (m): 0 to .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039402	Metagenome / Metatranscriptome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073580_1166211	F039402	AGGAGG	MSLADYTDLEREIADAPEPKILPRGAEVKARIVNVHEGISDKNGAQWYMPVFDVPNDPMVIEFKDFFWDLADRDKLDPKQAQRSIYKFKQFASAFGIDYSKPFSWTDDLVGLEGWLIVGVRKD