| Basic Information | |
|---|---|
| Taxon OID | 3300005263 Open in IMG/M |
| Scaffold ID | Ga0071346_1025519 Open in IMG/M |
| Source Dataset Name | Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3473 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humic Acid And/Or Glucose Under Anaerobic Conditions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Middleton, Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.0603 | Long. (o) | -89.5717 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020727 | Metagenome / Metatranscriptome | 222 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071346_10255191 | F020727 | GGA | MNKYQVLIKTVSGKGGEFWEAFKKMPTEPMKGVVIESSWSLYGFWDYVVFFKADSNENSLHFVGEVLRAMPGIADTS |
| ⦗Top⦘ |