| Basic Information | |
|---|---|
| Taxon OID | 3300005260 Open in IMG/M |
| Scaffold ID | Ga0074072_1000403 Open in IMG/M |
| Source Dataset Name | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Australian Centre for Ecogenomics |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 28111 |
| Total Scaffold Genes | 21 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 17 (80.95%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Biochar |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sydney | |||||||
| Coordinates | Lat. (o) | -33.917926 | Long. (o) | 151.235347 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030880 | Metagenome / Metatranscriptome | 184 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074072_10004035 | F030880 | N/A | MSEAYQYDDGCRLLIFRHADEECQALTAHYSGIRFNQVRLTFLPPSALQDTPDREEIEMTFNISGMPFDLTRHGFAHANWWRMVPPSGITHRCSTEGFGRAWRAIRTRTGYRLQGAQYVDGMTKLTVALKPIFHARRIVRGVTPLPSRW* |
| ⦗Top⦘ |