NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074072_1000010

Scaffold Ga0074072_1000010


Overview

Basic Information
Taxon OID3300005260 Open in IMG/M
Scaffold IDGa0074072_1000010 Open in IMG/M
Source Dataset NameMicrobial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)144061
Total Scaffold Genes116 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)91 (78.45%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Biochar

Source Dataset Sampling Location
Location NameSydney
CoordinatesLat. (o)-33.917926Long. (o)151.235347Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023910Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
Ga0074072_100001014F023910GAGGMHDSHFSPVEERKAAPRASDPDDSRVSPSSSRMLTNYLADVEQNLEEHRWEMALRDVVDLPKIAVALANPEMRSSREQCTAWCEQWVRPPEATNDSGVDHEHICRVLDESAGDSGAAVPTLALRRLRLRRHARHAPRGFNGASAIKDHEDRAETFAVCTAVVDGMRRWYAHFACHDATAQANLARLAVLR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.