NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074071_1009600

Scaffold Ga0074071_1009600


Overview

Basic Information
Taxon OID3300005258 Open in IMG/M
Scaffold IDGa0074071_1009600 Open in IMG/M
Source Dataset NameMicrobial communities on the surface of bentonite enhanced biochar
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2384
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → unclassified Kofleriaceae → Kofleriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Bentonite Enhanced Biochar

Source Dataset Sampling Location
Location NameSydney
CoordinatesLat. (o)-33.917926Long. (o)151.235347Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050648Metagenome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0074071_10096002F050648GAGMASALDTIVHLVLPNVMKLKTAATLIAAAERRDGSPFAHVWQQTGVAHTPQLSAKEKGDYRFGVMSLPTPTQMGEAYMCAFVVKKADPGTSHYFTLEYDYSLATKQAKTIVCGREGQRTVKHGDGPPITGDFQADATAFVDAIINVLAPTKVNPNRSY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.