| Basic Information | |
|---|---|
| Taxon OID | 3300005253 Open in IMG/M |
| Scaffold ID | Ga0073583_1181991 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial community near Loki's castle |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Uppsala University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 31636 |
| Total Scaffold Genes | 74 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 40 (54.05%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Community From Loki's Castle, Arctic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Loki's castle hydrothermal vent | |||||||
| Coordinates | Lat. (o) | 73.763167 | Long. (o) | 8.464 | Alt. (m) | Depth (m) | .74 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008189 | Metagenome / Metatranscriptome | 337 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073583_118199111 | F008189 | AGGAGG | MDYQEELKRLQESGNYWKPKVGQYKIKALTELEDTDPYIRRHDDKEDEVSPQAKIKILVEGEEKDWTFGKGKTPLSTFGQLIELATKHANQLTDLEFSVVVKSDGTKNEYTIVG* |
| ⦗Top⦘ |