Basic Information | |
---|---|
Taxon OID | 3300005253 Open in IMG/M |
Scaffold ID | Ga0073583_1142903 Open in IMG/M |
Source Dataset Name | Marine sediment microbial community near Loki's castle |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Uppsala University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 23657 |
Total Scaffold Genes | 34 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 13 (38.24%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Community From Loki's Castle, Arctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Loki's castle hydrothermal vent | |||||||
Coordinates | Lat. (o) | 73.763167 | Long. (o) | 8.464 | Alt. (m) | Depth (m) | .74 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029984 | Metagenome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073583_114290319 | F029984 | N/A | MRTNIVIDDELKEKWWEIKREADHLNMKIGDYIIFCHDLRKKMVNKDKILEILEDPLSEGLKNVDVIKASKSMWKS* |
⦗Top⦘ |