Scaffold Ga0073583_1071437

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073583_1071437

Scaffold Ga0073583_1071437

Overview

Basic Information
Taxon OID	3300005253 Open in IMG/M
Scaffold ID	Ga0073583_1071437 Open in IMG/M
Source Dataset Name	Marine sediment microbial community near Loki's castle
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Uppsala University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	43094
Total Scaffold Genes	81 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	73 (90.12%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Community From Loki's Castle, Arctic Ocean

Source Dataset Sampling Location
Location Name	Loki's castle hydrothermal vent
Coordinates	Lat. (^o)	73.763167	Long. (^o)	8.464	Alt. (m)		Depth (m)	.74
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035608	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073583_107143774	F035608	AGCAG	MAEAPGAEALMAIADTNAIIVSYLTTSSTKVDPLIALVASRVYCPRLPEKATLPAVGLFTRGGAPNPHIPGILTPSVQFDCWAANSIDARNVYRKLYDALQGIQNVTVGSYQIMSAIEETSGQDLVDVEIPNYFRVLSFFLFMIRAE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.