| Basic Information | |
|---|---|
| Taxon OID | 3300005247 Open in IMG/M |
| Scaffold ID | Ga0068637_1015727 Open in IMG/M |
| Source Dataset Name | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 833 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming: Yellowstone National Park | |||||||
| Coordinates | Lat. (o) | 44.539 | Long. (o) | -110.798 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009403 | Metagenome / Metatranscriptome | 318 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068637_10157273 | F009403 | AGG | VFRITRRGRGSGRAPALSVIRSGARLEVREGRYGRGALYAWCDVDDSLAAHTLLLTFADMRARVIYICDPLPLISERRFFLICSGDVDPDSLPDADSLADSDLRA* |
| ⦗Top⦘ |