Scaffold Ga0068641_110592

Overview

Basic Information

• Taxon OID: 3300005240
• Scaffold ID: Ga0068641_110592
• Source Dataset Name: Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1620
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: USA: Wyoming: Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.539
  • Long. (^o): -110.798

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105262	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068641_1105922	F105262	AGGAGG	MLVQETIQPLLRFFNANVTAPADTAVISIANTQAVRIVAHTGTVTGSASLQVHVNDTNNTNNSAQLTDKAITSLASNSSYEIFVTGAEAYAAKTLASHMFVRIAGTGTAQIAIEISAFPGRDIPASLPSNWTRVL*