NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073579_1484352

Scaffold Ga0073579_1484352


Overview

Basic Information
Taxon OID3300005239 Open in IMG/M
Scaffold IDGa0073579_1484352 Open in IMG/M
Source Dataset NameEnvironmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)818
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Environmental Genome Shotgun Sequencing: Ocean Microbial Populations From The Gulf Of Maine

Source Dataset Sampling Location
Location NameGulf of Maine, USA
CoordinatesLat. (o)43.2393Long. (o)-68.368612Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009845Metagenome / Metatranscriptome312Y

Sequences

Protein IDFamilyRBSSequence
Ga0073579_14843522F009845GAGGMFIFGKIKTYIIATLALALPIIYVMGQVKGRAKEKNKVLQDDLQAQKKTTNFYKKMAEHEADSLTGRKSLTDRLRGNGL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.