Scaffold Ga0073579_1468289

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073579_1468289

Scaffold Ga0073579_1468289

Overview

Basic Information
Taxon OID	3300005239 Open in IMG/M
Scaffold ID	Ga0073579_1468289 Open in IMG/M
Source Dataset Name	Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	902
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Environmental Genome Shotgun Sequencing: Ocean Microbial Populations From The Gulf Of Maine

Source Dataset Sampling Location
Location Name	Gulf of Maine, USA
Coordinates	Lat. (^o)	43.2393	Long. (^o)	-68.368612	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089510	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073579_14682892	F089510	GGA	MLQVSNLKIKLLDKVIAKRWLELCKGLNAGPDHIIDNAGISDNDFVKDIDQANKLFGFGWPTNPSTQEEYNKMHKDIETAPKDKADVLQNIHSHLHIKESGSNKASHVQIVWSESLGQFYKKQPIDCNMPEDAEPFDKTISYGDVYLGYPHIGKSPEVCMLQNDNSNLNQTCRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.