Scaffold Ga0073692_1074645

Overview

Basic Information

• Taxon OID: 3300005238
• Scaffold ID: Ga0073692_1074645
• Source Dataset Name: Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, Australia
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Australian Centre for Ecogenomics
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Biochar

Source Dataset Sampling Location

• Location Name: Sydney
• Coordinates
  • Lat. (^o): -33.91794
  • Long. (^o): 151.235369

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040349	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073692_10746452	F040349	N/A	MVSETALKEGLRQAHAALRAGQAATAERRLRALEQQFPGEINCLWLLGATLLDQGRTAESRALLETVLVRAPEFR