NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066627_1349253

Scaffold Ga0066627_1349253


Overview

Basic Information
Taxon OID3300005233 Open in IMG/M
Scaffold IDGa0066627_1349253 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_135m_RNA (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)786
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)135
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070840Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0066627_13492531F070840N/AMPKDVEKGEQSPLVLGNTKLLEALGSYRGENKRGGLGTLPDVPVGGHPGNDHFYDVVQLAVRLTVMCMLIGCMVWLPDTTKAMGMQRFAPFAGLAACLMCFFSTYSIGGVLQTASAGVSGCFTACLNIFLLRGFFPDGVTPGMGFTSTPSIVGWLDLALFNLAVLGFNCRMGFRMTGMAVNVGFMMCFLNPADKTVFSKNFQINPNGAAVTTFLGVCIGSLCAILAVGLPYPLGWATKNMKAAGMTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.