| Basic Information | |
|---|---|
| Taxon OID | 3300005225 Open in IMG/M |
| Scaffold ID | Ga0073353_1038864 Open in IMG/M |
| Source Dataset Name | Hotspring Microbial Communities from Lower Geyser Basin, Spring Unknown 43 (Mound Spring), Yellowstone National Park, Wyoming, USA ? Sample 3, bulk metagenomes as controls for mini-metagenomic methods |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Stanford University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5225 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Near-Boiling (>90C) → Alkaline → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.564833 | Long. (o) | -110.86325 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015070 | Metagenome / Metatranscriptome | 257 | Y |
| F051766 | Metagenome / Metatranscriptome | 143 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073353_10388644 | F051766 | N/A | MAIKKQGIVSGSYAFSGVEDNGLVTLTSPIDDIYIIEIQSLTQLFNFISPYDIPIMVDNTIYQVTNVADYSSASDTLIYSTVNTPRGSKTIIECEIKAIGIKPNSSVIFSTQERWIVYPEKTYQLVDGGTQSFTFTDNSIAYLRLTGKRILPTQLTSAYR* |
| Ga0073353_10388645 | F015070 | GGAGG | MMEELEKEGFVGIADYVDHPSWESPEWKALNREFFTVLVDDLLDFLWEYYLPL* |
| ⦗Top⦘ |