| Basic Information | |
|---|---|
| Taxon OID | 3300005223 Open in IMG/M |
| Scaffold ID | Ga0073350_126414 Open in IMG/M |
| Source Dataset Name | Sylvan Springs Unknown 12.1A - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Stanford University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1475 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.699217 | Long. (o) | -110.767467 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090627 | Metagenome / Metatranscriptome | 108 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073350_1264142 | F090627 | N/A | VIYDDTNAITTQFLQYLQNMLQGTVPTVNNIYVLAKPIGTQINLNNLTFQNNYQQVNMIFLNQYVPQPIEALELWISTSVGNYPVAVLQFQSPITQSGELAVQWSISIQVPLIVQGAETFGISNSIPQILMQLFIPQQYFSTPIQLTSTQPTLQIVSSPQVTPTFIAPSEAGVGAVAYITTSSTISTLSALLYLLGQYIMTVSQNDLNEQAVNSLIIASAFITLTSSNITSVVP* |
| ⦗Top⦘ |