Scaffold Ga0073350_110471

Overview

Basic Information

• Taxon OID: 3300005223
• Scaffold ID: Ga0073350_110471
• Source Dataset Name: Sylvan Springs Unknown 12.1A - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Stanford University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 949
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.699217
  • Long. (^o): -110.767467
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094112	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073350_1104712	F094112	GAG	MSQSNIAVYNRGYNTITITDPTTGKTSVNLGLTTYNYPILAIHIYINNTSNPASGYVKAVITPLDELVTGYTGYSPTIEYFIDAYKGAMYIPLAPHEYVNITISISAGANLLYDAFLYDWMGER*