Basic Information | |
---|---|
Taxon OID | 3300005208 Open in IMG/M |
Scaffold ID | Ga0069003_10041769 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 753 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: San Francisco Bay, California | |||||||
Coordinates | Lat. (o) | 38.107536 | Long. (o) | -121.649704 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011857 | Metagenome / Metatranscriptome | 286 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0069003_100417691 | F011857 | AGG | MERQKVVGTNCYNCMYVSKNSETVESKELNSQGGIDQSTDDTLKKAEKADLITLPGGSAADTTDKKFCNHPKIQMYVTGRMCCAYWENPGARRPWKLKSKEAQTAIA* |
⦗Top⦘ |