Scaffold Ga0072941_1172105

Overview

Basic Information

• Taxon OID: 3300005201
• Scaffold ID: Ga0072941_1172105
• Source Dataset Name: Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1005
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location

• Location Name: Indooroopilly, Australia
• Coordinates
  • Lat. (^o): -27.5
  • Long. (^o): 152.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023893	Metagenome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072941_11721053	F023893	N/A	MFQDKNGGRSRSTKIDNSSFERVEEFKYLGTALTNQNSIPEEI