| Basic Information | |
|---|---|
| Taxon OID | 3300005200 Open in IMG/M |
| Scaffold ID | Ga0072940_1211266 Open in IMG/M |
| Source Dataset Name | Nasutitermes gut metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Queensland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 756 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Termite Gut Microbial Communities From Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Murphy's Creek, Queensland, Australia | |||||||
| Coordinates | Lat. (o) | -27.45 | Long. (o) | 152.04 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071357 | Metagenome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0072940_12112662 | F071357 | GAG | LAVRKQTTQKSDGERFNIRELNKLEVRKQYQIEITNRLAALENLIDK* |
| ⦗Top⦘ |